DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP005690

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001688708.1 Gene:AgaP_AGAP005690 / 5667342 VectorBaseID:AGAP005690 Length:300 Species:Anopheles gambiae


Alignment Length:242 Identity:69/242 - (28%)
Similarity:109/242 - (45%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISL---RLRGEHYCGGVIISATHVITAGHCVKHGND--------VVPAD 89
            ||..|.:|..||||.||:|   ...|...|||.:::...::||.|||..|..        ::.|.
Mosquito    55 RITNGQEATPGQFPFQIALISEFASGNGLCGGSVLTRNFILTAAHCVVSGASTLASGGVAIMGAH 119

  Fly    90 LWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPP- 152
            ..:||..    :...:|...:.:..||:|::.. .||:|.:||.||:||...|..|:|...... 
Mosquito   120 NRNIQES----TQQRIRFATSGIRRHPSYSSSTLRNDIATVRLNSPMTFTTRIQPIRLPGRSDTR 180

  Fly   153 --NCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGAC--RWMFYSRLPETMICLLHSKNSGAC 212
              ......:||:|..::....:.::: |.....::...|  ||  .|.:....:||..:....:|
Mosquito   181 QFGGFTGTVSGFGRTSDASSATSAVVRFTTNPVMTNTDCIARW--GSTVVNQHVCLSGAGGRSSC 243

  Fly   213 YGDSGGPATY--GGKV-VGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            .||||||.|.  ||.: :|:.|.....||....|..|.|::....||
Mosquito   244 NGDSGGPLTVQSGGTMQIGVVSFGSVNGCAIGMPSVYARVTFFLDWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 67/240 (28%)
Tryp_SPc 37..219 CDD:238113 54/199 (27%)
AgaP_AGAP005690XP_001688708.1 Tryp_SPc 55..290 CDD:214473 67/240 (28%)
Tryp_SPc 56..290 CDD:238113 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.