DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006485

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001688885.1 Gene:AgaP_AGAP006485 / 5667297 VectorBaseID:AGAP006485 Length:281 Species:Anopheles gambiae


Alignment Length:269 Identity:82/269 - (30%)
Similarity:124/269 - (46%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLC-GVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            ||..:|.|. .:..|.|.:|   :||.. .||::||..|..||||..:|:......:|||.::..
Mosquito     3 WTAFVLCLAVALPCIRGDNV---ESEDR-SPRLIGGTNAPWGQFPSAVSINTTFNVHCGGAVVDR 63

  Fly    70 THVITAGHCVKHGNDVVPADLW-SIQAGSLLLSSDGVR---IPVAEVIMHP--NYATGGHNDLAV 128
            .||:||..||.:.|..:....| :::||.:.|:..|.|   ..|:.:.:||  |..|..| |:||
Mosquito    64 QHVLTAAQCVFNANLRLVDPYWITVRAGDIALAPVGARRQTRKVSHIFVHPQFNIRTLEH-DVAV 127

  Fly   129 LRLQSPLTFDANIAAIQLATED---PPNCVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGAC 188
            |||..|....:|  .|.||...   .||..:...:|||  ..|...|::....|:.:|...|..|
Mosquito   128 LRLDRPYDLPSN--TINLANRTRRIVPNGASCQFAGWGASTAALNAPVNVLQRFLPMTVNDRDMC 190

  Fly   189 RW--MFYSRLPETMICLLH---SKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYL 247
            ..  |...|:.|:.:|..:   |.|:..|.|::|........:||  :|..|..||.| .|..:.
Mosquito   191 NQANMHAGRMLESHLCAGNTGGSNNAAPCNGNAGTGLYCERALVG--TLSFGLNCGAANNPPVFT 253

  Fly   248 RISKVRAWI 256
            ::.....||
Mosquito   254 QVRFYNDWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/236 (30%)
Tryp_SPc 37..219 CDD:238113 61/197 (31%)
AgaP_AGAP006485XP_001688885.1 Tryp_SPc 30..262 CDD:214473 70/236 (30%)
Tryp_SPc 32..265 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.