DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and PRTN3

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_002768.3 Gene:PRTN3 / 5657 HGNCID:9495 Length:256 Species:Homo sapiens


Alignment Length:268 Identity:78/268 - (29%)
Similarity:127/268 - (47%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLR---GEHYCGGVI 66
            |.:|||.||.              |.:|....||||.:|:....|:..||::|   |.|:|||.:
Human    10 LASVLLALLL--------------SGAARAAEIVGGHEAQPHSRPYMASLQMRGNPGSHFCGGTL 60

  Fly    67 ISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVR--------IPVAEVIMHPNYATGGH 123
            |..:.|:||.||::.    :|..|.::     :|.:..||        ..||:|.::...|....
Human    61 IHPSFVLTAAHCLRD----IPQRLVNV-----VLGAHNVRTQEPTQQHFSVAQVFLNNYDAENKL 116

  Fly   124 NDLAVLRLQSPLTFDANIAAIQLATEDPP-----NCVAVDISGWGNIAEKGPLSDSLLFVQVTSI 183
            ||:.:::|.||....|::|.:||..:|.|     .|:|:   |||.:....|.:..|..:.||.:
Human   117 NDVLLIQLSSPANLSASVATVQLPQQDQPVPHGTQCLAM---GWGRVGAHDPPAQVLQELNVTVV 178

  Fly   184 SRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLR 248
            :       |:.| |..:...:..:.:|.|:||||||....|.:.|:.|.::.|...|..||.:.|
Human   179 T-------FFCR-PHNICTFVPRRKAGICFGDSGGPLICDGIIQGIDSFVIWGCATRLFPDFFTR 235

  Fly   249 ISKVRAWI 256
            ::....||
Human   236 VALYVDWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/235 (29%)
Tryp_SPc 37..219 CDD:238113 58/197 (29%)
PRTN3NP_002768.3 Tryp_SPc 28..246 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.