DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and KLK10

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:268 Identity:74/268 - (27%)
Similarity:112/268 - (41%) Gaps:39/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            ||.|...|:...:.....|:::.::|...|...|: |..|.|:||......:|.||::..:.|:|
Human    20 LLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCAR-GSQPWQVSLFNGLSFHCAGVLVDQSWVLT 83

  Fly    75 AGHCVKHGNDVVPADLWSIQAGS---LLLSSDGVRIPVAEVIMHPNYATGG---------HNDLA 127
            |.||   ||    ..||: :.|.   |||..:.:|.....|: ||.|..|.         .:||.
Human    84 AAHC---GN----KPLWA-RVGDDHLLLLQGEQLRRTTRSVV-HPKYHQGSGPILPRRTDEHDLM 139

  Fly   128 VLRLQSPLTFDANIAAIQLATEDPPNCV----AVDISGWG-NIAEKGPLSDSLLFVQVTSISRGA 187
            :|:|..|:.....:.|:||    |..|.    ...::||| ..|.:...:..|....:|.:|...
Human   140 LLKLARPVVLGPRVRALQL----PYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKE 200

  Fly   188 CRWMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG---CGRAA-PDGYLR 248
            |...:...:...|||....:....|..|||||......:.|    :|..|   ||.|. |..|.:
Human   201 CEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQG----ILSWGVYPCGSAQHPAVYTQ 261

  Fly   249 ISKVRAWI 256
            |.|..:||
Human   262 ICKYMSWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/240 (28%)
Tryp_SPc 37..219 CDD:238113 54/198 (27%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 68/239 (28%)
Tryp_SPc 49..269 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.