DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and KLK6

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:234 Identity:64/234 - (27%)
Similarity:96/234 - (41%) Gaps:30/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            ::|.|....:...|:|.:|...|...||||:|....|:||.||.|....|             .|
Human    21 KLVHGGPCDKTSHPYQAALYTSGHLLCGGVLIHPLWVLTAAHCKKPNLQV-------------FL 72

  Fly   101 SSDGVR--------IPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDPPNCVA 156
            ....:|        ..|...::||:|....|: |:.:|||..|......|..:.|..:...|..:
Human    73 GKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTS 137

  Fly   157 VDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSK-NSGACYGDSGGPA 220
            ..|.|||..|: |...|::....:..:||..|...:..::.:.|:|....| ...:|.||||||.
Human   138 CHILGWGKTAD-GDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGKDSCQGDSGGPL 201

  Fly   221 TYGGKVVGLASLLLGGG--CG-RAAPDGYLRISKVRAWI 256
            ..|..:.||.|   .|.  || :..|..|..:.:...||
Human   202 VCGDHLRGLVS---WGNIPCGSKEKPGVYTNVCRYTNWI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/232 (27%)
Tryp_SPc 37..219 CDD:238113 51/191 (27%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 62/230 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.