DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:266 Identity:74/266 - (27%)
Similarity:116/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISAT 70
            :|:||:    |.::.|..          :.||:||.:.:.....:|.|::....|||||.:|...
Zfish     7 YTLLLI----VSMLQGSK----------QQRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQ 57

  Fly    71 HVITAGHCVKHGNDVVPADLWSIQAGSLLLSS-DGVR--IPVAEVIMH--PNYATGGHNDLAVLR 130
            .|::|.||.:      |:.|..:......||. :|..  ..|::.::|  .||.| ..:|:.:|:
Zfish    58 WVVSAAHCWR------PSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYRT-FDSDIMLLK 115

  Fly   131 LQSPLTFDANIAAIQLATEDP-----PNCVAVDISGWG-NIAEKGPLSDSLLFVQVTSISRGACR 189
            |:.|....|.|....|....|     ..|:   :|||| .......||..|..|.|..|.:  |:
Zfish   116 LEKPAELSATIQPAVLPVSVPALQGGTVCI---VSGWGVTQVYSYYLSPVLRAVDVQIIPQ--CQ 175

  Fly   190 WMFYSRLPETMICL---LHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRIS 250
            :.:|.|:.:.|:|.   |..|:|  |.||||||....|...|:.|  .|..|..| .|..|.::.
Zfish   176 YYYYYRITDNMVCAGSPLGGKDS--CQGDSGGPLICNGYFEGIVS--WGISCANAYFPGVYTKVR 236

  Fly   251 KVRAWI 256
            ....|:
Zfish   237 NYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/234 (29%)
Tryp_SPc 37..219 CDD:238113 57/195 (29%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 68/233 (29%)
Tryp_SPc 24..241 CDD:238113 67/232 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.