DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and MASP1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011511291.1 Gene:MASP1 / 5648 HGNCID:6901 Length:735 Species:Homo sapiens


Alignment Length:285 Identity:74/285 - (25%)
Similarity:127/285 - (44%) Gaps:56/285 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NQSESAIEPRIVGGIKAKQGQFPHQISL------RLRGEHYCG-GVIISATHVITAGHCV---KH 81
            ::|..::..||:||..|:.|.||.|..:      |:..:.:.| |.::||:.::||.|.:   :.
Human   447 SRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSASWILTAAHVLRSQRR 511

  Fly    82 GNDVVPADLWSIQAGSLLL-------SSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFD 138
            ...|:|.   |.:..::.|       .|..|....|.|::||::....:| |:|:::||.|:...
Human   512 DTTVIPV---SKEHVTVYLGLHDVRDKSGAVNSSAARVVLHPDFNIQNYNHDIALVQLQEPVPLG 573

  Fly   139 ANIAAIQLATEDP----PNCVAVDISGWG---------NIAEKG--PLSDSLLFVQVTSISRGAC 188
            .::..:.|...:|    |:.:.: ::|||         .|...|  .|||.|.:|::..:....|
Human   574 PHVMPVCLPRLEPEGPAPHMLGL-VAGWGISNPNVTVDEIISSGTRTLSDVLQYVKLPVVPHAEC 637

  Fly   189 RWMFYSR-----LPETMICL-LHSKNSGACYGDSGG------PATYGGKVVGLASLLLGGG---C 238
            :..:.||     :.|.|.|. .:......|.|||||      ..:....|.||.|   .||   |
Human   638 KTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDDLSQRWVVQGLVS---WGGPEEC 699

  Fly   239 GRAAPDG-YLRISKVRAWIAEKAGL 262
            |.....| |.::|....|:.|:.||
Human   700 GSKQVYGVYTKVSNYVDWVWEQMGL 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/268 (26%)
Tryp_SPc 37..219 CDD:238113 57/226 (25%)
MASP1XP_011511291.1 CUB 35..144 CDD:238001
FXa_inhibition 160..188 CDD:291342
CUB 192..301 CDD:278839
Sushi 308..369 CDD:278512
CCP 374..439 CDD:153056
Tryp_SPc 456..718 CDD:214473 69/268 (26%)
Tryp_SPc 457..718 CDD:238113 68/267 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.