DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and PRSS2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:254 Identity:73/254 - (28%)
Similarity:111/254 - (43%) Gaps:48/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK------------------ 80
            :.:||||...::...|:|:||. .|.|:|||.:||...|::||||.|                  
Human    21 DDKIVGGYICEENSVPYQVSLN-SGYHFCGGSLISEQWVVSAGHCYKSAINSKLSGRGCEYHRIQ 84

  Fly    81 -----HGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDA 139
                 |..:|:..:...|.|              |::|.||.|.:.. .||:.:::|.||...::
Human    85 VRLGEHNIEVLEGNEQFINA--------------AKIIRHPKYNSRTLDNDILLIKLSSPAVINS 135

  Fly   140 NIAAIQLATEDPPNCVAVDISGWGNIAEKG-PLSDSLLFVQVTSISRGACRWMFYSRLPETMIC- 202
            .::||.|.|..|.......||||||....| ...|.|..:....:|:..|...:..::...|.| 
Human   136 RVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCV 200

  Fly   203 --LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWIAE 258
              |...|:|  |.||||||....|::.|:.|  .|.||. :..|..|.::.....||.:
Human   201 GFLEGGKDS--CQGDSGGPVVSNGELQGIVS--WGYGCAQKNRPGVYTKVYNYVDWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/248 (29%)
Tryp_SPc 37..219 CDD:238113 61/209 (29%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 71/248 (29%)
Tryp_SPc 24..256 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.