DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and PRSS1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:238 Identity:72/238 - (30%)
Similarity:109/238 - (45%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK---------HGNDVVPAD 89
            :.:||||...::...|:|:||. .|.|:|||.:|:...|::||||.|         |..:|:..:
Human   246 DDKIVGGYNCEENSVPYQVSLN-SGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGN 309

  Fly    90 LWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPPN 153
            ...|.|              |::|.||.|.... :||:.:::|.|....:|.::.|.|.|..|..
Human   310 EQFINA--------------AKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPAT 360

  Fly   154 CVAVDISGWGNIAEKG-PLSDSLLFVQVTSISRGACRWMFYSRLPETMIC---LLHSKNSGACYG 214
            .....||||||.|..| ...|.|..:....:|:..|...:..::...|.|   |...|:|  |.|
Human   361 GTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDS--CQG 423

  Fly   215 DSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAWI 256
            |||||....|::.|:.|  .|.||. :..|..|.::.....||
Human   424 DSGGPVVCNGQLQGVVS--WGDGCAQKNKPGVYTKVYNYVKWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 70/234 (30%)
Tryp_SPc 37..219 CDD:238113 60/195 (31%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 70/234 (30%)
Tryp_SPc 249..467 CDD:238113 72/235 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.