DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC560023

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:272 Identity:79/272 - (29%)
Similarity:121/272 - (44%) Gaps:54/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            ||..|:|      .::.:|        |...||:||.:.......:|:||::..:|:|||.:|..
Zfish    26 LWVFLVL------AVMVRD--------AFSQRIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQP 76

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRI--------PVAEVIMHPNY-ATGGHND 125
            ..|:||.||.:      ||.:  ||   ::||...:.:        .||:|..|..| ....:||
Zfish    77 QWVLTAAHCWR------PASV--IQ---VVLSEHNLAVEEGFEQVCTVAKVFSHVAYNPKTFNND 130

  Fly   126 LAVLRLQSPLTFDANIAAIQLATEDPPNCV---AVDISGWG-----NIAEKGPLSDSLLFVQVTS 182
            :.:::|.:|...:|.:....|.|.|.|...   :..:||||     |..    ||..|..|.|..
Zfish   131 IMIIKLTAPAQINAYVQPALLPTADTPELAGGSSCTVSGWGVTRLYNFY----LSPILRAVDVEI 191

  Fly   183 ISRGACRWMFYSRLPETMICLLHSKNSG--ACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APD 244
            .|  :|:..:|.|:.:.||| ..|:..|  :|.||||||....|.:.|:.|  .|.||... .|.
Zfish   192 FS--SCQLYYYYRVNDNMIC-AGSRFGGKDSCQGDSGGPLICDGYLEGIVS--WGIGCALPYYPG 251

  Fly   245 GYLRISKVRAWI 256
            .|.::.....||
Zfish   252 VYTKVRNYNRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/239 (30%)
Tryp_SPc 37..219 CDD:238113 60/200 (30%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.