DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC548809

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001016055.2 Gene:LOC548809 / 548809 -ID:- Length:334 Species:Xenopus tropicalis


Alignment Length:297 Identity:91/297 - (30%)
Similarity:135/297 - (45%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSES-------AIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGV 65
            ::||||    |.....|:||.:.|       .:..|||||..|..|.:|.|||||.:|.|.|||.
 Frog    26 IILLLL----VSASPTVSQNTTASPRICGSPLVSSRIVGGTDATNGAWPWQISLRYKGSHICGGS 86

  Fly    66 IISATHVITAGHCVKHGNDVVPADL--------WSIQAGSLLLSSDGVRIPVAEVIMHPNYA-TG 121
            :||...::||.||.::..  .|:|.        .|:.:.|.||||      ||.||::|::. .|
 Frog    87 VISNQWIMTAAHCFEYSR--TPSDYQVLLGAYQLSVASASELLSS------VARVIVNPSFTIPG 143

  Fly   122 GHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD-----------ISGWGNI--AEKGPLSD 173
            |..|:|:|:|.||:.:...|.         |.||...           ::|||||  |...|...
 Frog   144 GPGDIALLKLTSPVAYTEYIL---------PVCVPSSASGFYEGMQCWVTGWGNIGSAVTLPYPQ 199

  Fly   174 SLLFVQVTSISRGACRWMFYSR---------LPETMICLLHSK-NSGACYGDSGGPAT------- 221
            :|..|....||...|..|::.:         :|:..||..::. ...:|.||||||..       
 Frog   200 TLQQVMTPLISWSTCNQMYHVQSGISSNIAIVPKDQICAGYAAGQKDSCQGDSGGPLVCQLQGVW 264

  Fly   222 YGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIA 257
            |   .:|:.|  .|.||.:|: |..|..:...::|::
 Frog   265 Y---QIGIVS--WGDGCAQASRPGVYTLVPNFKSWLS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 81/259 (31%)
Tryp_SPc 37..219 CDD:238113 69/213 (32%)
LOC548809NP_001016055.2 Tryp_SPc 57..294 CDD:214473 81/258 (31%)
Tryp_SPc 58..297 CDD:238113 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.