DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tpsg1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012826218.1 Gene:tpsg1 / 548372 XenbaseID:XB-GENE-5893000 Length:297 Species:Xenopus tropicalis


Alignment Length:297 Identity:93/297 - (31%)
Similarity:141/297 - (47%) Gaps:56/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WTTLWTVLLLLLCGVQVILGQD-----------VAQNQSES--------AIEPRIVGGIKAKQGQ 47
            |:.|...||||..||.|:.|.|           :..|..::        .|:.|||||..|.:|:
 Frog     3 WSHLLRALLLLNLGVYVLAGYDNSDYDQDNDDEIDDNDDDNKPTCGTPVKIDNRIVGGQDAMKGK 67

  Fly    48 FPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGND---VVPADLWSIQAGSLLLSSDGVRIPV 109
            .|.|:.:.:.|..||||.:||:..|:|..||:...|.   ||....:.|...    .::...:||
 Frog    68 NPWQVIVWIPGSGYCGGALISSNLVVTVAHCIDGFNASSVVVILGAYKITGN----PNEENSVPV 128

  Fly   110 AEVIMHPNYATGGHN-DLAVLRLQS--PLT-FDANIAAIQLATEDPP--NCVAVDISGWGNIAEK 168
            .::|:||:|....:: |:|:|:|..  |:| :...:.....:|..||  |||   ::|||:| |.
 Frog   129 QQIIIHPSYNESDNSADIALLQLSQNVPITRYIQPVCVPSASTVFPPGQNCV---VTGWGDI-EL 189

  Fly   169 GPLSDSLLFVQVTSI---SRGACRWMFY------SRLPETMICLLHSKNS-GACYGDSGGP-ATY 222
            ..:....:.:|.|.:   |...|: .:|      |.:.:.|||.:..... |.|.||.||| .||
 Frog   190 SVIPQRPVVLQETQVRLMSTEQCK-SYYDNKGVGSFIKDDMICAVDILGQRGPCLGDGGGPLVTY 253

  Fly   223 GGK---VVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            ..|   :||:||  .|.|||...|..|   :.|||:|
 Frog   254 QNKQWNLVGVAS--FGFGCGNENPAVY---TSVRAYI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 79/242 (33%)
Tryp_SPc 37..219 CDD:238113 60/200 (30%)
tpsg1XP_012826218.1 Tryp_SPc 56..288 CDD:214473 80/244 (33%)
Tryp_SPc 57..290 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.