DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tpsab1

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:286 Identity:84/286 - (29%)
Similarity:128/286 - (44%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTLWTVLLLLLCGVQVILGQDVAQNQSESAIEPR--IVGGIKAKQGQFPHQISLRLRGE---HYC 62
            ||....:|.||.....:|...|  :.:.|...||  ||||.:|...::|.|:|||:...   |:|
  Rat    32 TTHCVRMLKLLLLTLPLLSSLV--HAAPSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFC 94

  Fly    63 GGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPN-YATGGHNDL 126
            ||.:|....|:||.|||  |.:....:...:|.....|......:.|:::|.||: |......|:
  Rat    95 GGSLIHPQWVLTAAHCV--GPNKADPNKLRVQLRKQYLYYHDHLLTVSQIISHPDFYIAQDGADI 157

  Fly   127 AVLRLQSPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNI------AEKGPLSDSLLFVQVTSI 183
            |:|:|.:|:...:|:..:.|  |:|..|:.....::|||||      ....||.:    |||..:
  Rat   158 ALLKLTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEE----VQVPIV 218

  Fly   184 SRGACRWMFYSRL---------PETMICLLHSKNSG--ACYGDSGGPATYGGKV------VGLAS 231
            ....|...::..|         .:.|:|   :.|.|  :|.||||||...  ||      .|:.|
  Rat   219 ENRLCDLKYHKGLNTGDNVHIVRDDMLC---AGNEGHDSCQGDSGGPLVC--KVEDTWLQAGVVS 278

  Fly   232 LLLGGGCGRA-APDGYLRISKVRAWI 256
              .|.||.:. .|..|.|::....||
  Rat   279 --WGEGCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/251 (29%)
Tryp_SPc 37..219 CDD:238113 60/204 (29%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 72/248 (29%)
Tryp_SPc 66..302 CDD:238113 72/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.