DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Elane

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:288 Identity:71/288 - (24%)
Similarity:110/288 - (38%) Gaps:90/288 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIIS 68
            ||..:||.|..|              ..|:...||||..|:...:|...||:.||.|:||..:|:
Mouse    10 TLAAMLLALFLG--------------GPALASEIVGGRPARPHAWPFMASLQRRGGHFCGATLIA 60

  Fly    69 ATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH---------- 123
            ...|::|.|||                       :|:.....:|::      |.|          
Mouse    61 RNFVMSAAHCV-----------------------NGLNFRSVQVVL------GAHDLRRQERTRQ 96

  Fly   124 ------------------NDLAVLRLQSPLTFDANIAAIQLATE-----DPPNCVAVDISGWGNI 165
                              ||:.:::|....|.:||:...||..:     |...|:|:   |||.:
Mouse    97 TFSVQRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPCLAM---GWGRL 158

  Fly   166 AEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMIC-LLHSKNSGACYGDSGGPATYGGKVVGL 229
            ....|....|..:.||.:: ..||       ....:| |:..:.:|.|:||||||......|.|:
Mouse   159 GTNRPSPSVLQELNVTVVT-NMCR-------RRVNVCTLVPRRQAGICFGDSGGPLVCNNLVQGI 215

  Fly   230 ASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            .| .:.||||... ||.:..:::...||
Mouse   216 DS-FIRGGCGSGLYPDAFAPVAEFADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 62/254 (24%)
Tryp_SPc 37..219 CDD:238113 51/215 (24%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 62/254 (24%)
Tryp_SPc 29..245 CDD:238113 64/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.