DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss53

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:275 Identity:70/275 - (25%)
Similarity:110/275 - (40%) Gaps:74/275 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQ----NQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVI 66
            |...||::..|.||.|...||    .:.....||:....:   .|::|.|.|:|.:|.|.|.|.:
  Rat     5 WGPELLIVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTL---PGEWPWQASVRRQGVHICSGSL 66

  Fly    67 ISATHVITAGHCVKHGNDVVPADL--WSIQAGSLL---LSSDGVRIPVAEVIM---HPNYATGGH 123
            ::.|.|:||.||.:   .:..|:|  ||:..|||.   ||.....:.||.:.:   :.:|:.|  
  Rat    67 VADTWVLTAAHCFE---KMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQG-- 126

  Fly   124 NDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKG------------------- 169
            :|||:|:|..|:..  ....:...|...|...:...:||......|                   
  Rat   127 SDLALLQLTHPIVH--TTLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTV 189

  Fly   170 ------------------PLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNS------- 209
                              |:|.:|..:::..|||..|..: |:||.:.:  |.:...|       
  Rat   190 LALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCL-YNRLHQRL--LANPARSGMLCGGA 251

  Fly   210 -----GACYGDSGGP 219
                 |.|.||||||
  Rat   252 QPGVQGPCQGDSGGP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 59/241 (24%)
Tryp_SPc 37..219 CDD:238113 57/238 (24%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 59/232 (25%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.