DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Prss36

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:276 Identity:88/276 - (31%)
Similarity:130/276 - (47%) Gaps:48/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDVAQNQSESAIE----------PRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAG 76
            ||.|.:.::...|          .|||||..|..|.:|.|:||...|.|.|||.:|:.:.|::|.
  Rat    34 QDSAVSPTQGEFEDLDCGRPEPSSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAA 98

  Fly    77 HCVKHGNDVVPADLWSIQAGSLLLSSDG------VRIPVAEVIMHPNYA---TGGHNDLAVLRLQ 132
            ||......:.|||.||:..|  :.|.||      :| .||.:::..||:   .|.  |||:|||.
  Rat    99 HCFVTNGTLEPADEWSVLLG--VHSQDGPLEGAHMR-SVATILVPDNYSRVELGA--DLALLRLA 158

  Fly   133 SPLTFDANIAAIQL--ATEDPPNCVAVDISGWGNIAEKGPLSDS--LLFVQVTSISRGACRWMFY 193
            ||.....::..:.|  |:....:..|...:|||::.|..||...  |..|::..:...||:.: |
  Rat   159 SPAKLGPSVKPVCLPRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCL-Y 222

  Fly   194 SR----------LPETMICLLHSK-NSGACYGDSGGPATY--GGK--VVGLASLLLGGGCGRA-A 242
            ||          || .|:|..:.: ....|.||||||...  ||:  :.|:.|  .|.||||. .
  Rat   223 SRPGPFNLTLQLLP-GMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITS--FGFGCGRRNR 284

  Fly   243 PDGYLRISKVRAWIAE 258
            |..:..::...:||.|
  Rat   285 PGVFTAVAHYESWIRE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 81/248 (33%)
Tryp_SPc 37..219 CDD:238113 68/205 (33%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 83/251 (33%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.