DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and LOC496633

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011204.1 Gene:LOC496633 / 496633 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:263 Identity:68/263 - (25%)
Similarity:108/263 - (41%) Gaps:31/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LWTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            || :||.|.......|..|            :||||.:......|.|:......:.:|||.:::.
 Frog     4 LW-ILLFLAVAAAAPLDDD------------KIVGGYECTPHSQPWQVYFTQENQVFCGGSLVTP 55

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGV--RIPVAEVIMHPNYATGG-HNDLAVLRL 131
            ..:|:|.||.:     .|..|.:......|...:|.  .|.|..:..|.:|.... .:|:.:::|
 Frog    56 RWIISAAHCYR-----TPKTLVAHLGDHDLTKEEGTEQHIQVENIYKHFSYKDNDVDHDIMLVKL 115

  Fly   132 QSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEK--GPLSDSLLFVQVTSISRGACRWMFYS 194
            ..|..::..:..|.:|...|.......:||:||:...  |...|.|..|.|..:|..:|:..:..
 Frog   116 AKPAQYNQYVQPIPVARSCPREGTECLVSGYGNMRSDNIGEFPDRLQCVDVPVLSDSSCKASYRG 180

  Fly   195 RLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCG-RAAPDGYLRISKVRAW 255
            ...|.|.|   |...|:|  |..|||||....|::.|:.|  .|.||. |.||..|.::.....|
 Frog   181 LFTENMFCAGFLEGGKDS--CQVDSGGPLVCNGELYGVVS--WGQGCAERNAPGVYAKVCNYLGW 241

  Fly   256 IAE 258
            :.:
 Frog   242 VQD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 60/228 (26%)
Tryp_SPc 37..219 CDD:238113 48/189 (25%)
LOC496633NP_001011204.1 Tryp_SPc 23..245 CDD:238113 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.