DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and tmprss2

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001008623.1 Gene:tmprss2 / 494080 ZFINID:ZDB-GENE-041212-48 Length:486 Species:Danio rerio


Alignment Length:279 Identity:84/279 - (30%)
Similarity:126/279 - (45%) Gaps:46/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVQVILGQD---VAQNQSESAIE-----------PRIVGGIK-AKQGQFPHQISLRLRGEHYCGG 64
            |.|.||...   ::..||.:|:.           .|||||.. ..:|.:|.|:||...|.|.|||
Zfish   216 GYQGILSPSLDFISACQSSTAVSLKCTDCGRSTGNRIVGGTTVTSKGVWPWQVSLHYSGRHLCGG 280

  Fly    65 VIISATHVITAGHCVKHGNDVVPADLWSIQAGSL----LLSSDGVRIPVAEVIMHPNYATGGHND 125
            .||:...::||.|||...::  |.. |::.||.|    :.|:.|  ..|..:::|........||
Zfish   281 SIITPYWILTAAHCVHQFSN--PGG-WTVYAGYLTQSEMASASG--NSVNRIVIHDFNPNTNEND 340

  Fly   126 LAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD--ISGWGNIAEKGPLSDSLLFVQVTSISRGAC 188
            :|::||.:.||...||..:.|..:........|  ::|||.:...|..|.:|...::..|....|
Zfish   341 IALMRLNTALTISTNIRPVCLPNKGMSFTAQQDCYVTGWGALFSGGSSSATLQEAKIQLIDSTIC 405

  Fly   189 --RWMFYSRLPETMICLLHSKNSG---ACYGDSGGPATYGGKVVGLASL--LL-----GGGCG-R 240
              |.::...:.:||||.  .|.:|   :|.||||||.     |..:.||  ||     |.||. |
Zfish   406 NSRPVYNGLITDTMICA--GKLAGGVDSCQGDSGGPL-----VTNVRSLWWLLGDTSWGDGCAVR 463

  Fly   241 AAPDGYLRISKVRAWIAEK 259
            ..|..|..::....||.::
Zfish   464 NKPGVYGNVTYFLDWIYQQ 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/239 (31%)
Tryp_SPc 37..219 CDD:238113 61/193 (32%)
tmprss2NP_001008623.1 LDLa 132..168 CDD:238060
SRCR_2 173..248 CDD:295335 7/31 (23%)
Tryp_SPc 251..479 CDD:214473 75/239 (31%)
Tryp_SPc 252..482 CDD:238113 76/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.