DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and ACR

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001088.2 Gene:ACR / 49 HGNCID:126 Length:421 Species:Homo sapiens


Alignment Length:309 Identity:87/309 - (28%)
Similarity:129/309 - (41%) Gaps:84/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVI----------LGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRL-----RGE 59
            :||:..|.|:          .|....||.....   |||||..|:.|.:|..:||::     ...
Human     9 ILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGV---RIVGGKAAQHGAWPWMVSLQIFTYNSHRY 70

  Fly    60 HYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL---SSDGVRIPVAE-----VIMHP 116
            |.|||.::::..|:||.||....|:|..   |.:..|:..:   ::..|:.|:.|     :|:|.
Human    71 HTCGGSLLNSRWVLTAAHCFVGKNNVHD---WRLVFGAKEITYGNNKPVKAPLQERYVEKIIIHE 132

  Fly   117 NY--ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCV------------AVDISGWGNIAE 167
            .|  ||.| ||:|::.:..|::....|.         |.|:            :..::|||.|.|
Human   133 KYNSATEG-NDIALVEITPPISCGRFIG---------PGCLPHFKAGLPRGSQSCWVAGWGYIEE 187

  Fly   168 KGPLSDSLLF-VQVTSISRGAC---RWMFYSRLPETMICLLHSKNS-GACYGDSGGP-------- 219
            |.|...|:|. .:|..|....|   :| :..|:..|.:|..:.... ..|.||||||        
Human   188 KAPRPSSILMEARVDLIDLDLCNSTQW-YNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKDSKE 251

  Fly   220 ATYGGKVVGLASLLLGGGCGRAAPDG-------YLRISKVRAWIAEKAG 261
            :.|  .|||:.|  .|.||.||...|       ||.      |||.|.|
Human   252 SAY--VVVGITS--WGVGCARAKRPGIYTATWPYLN------WIASKIG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/266 (28%)
Tryp_SPc 37..219 CDD:238113 59/213 (28%)
ACRNP_001088.2 Tryp_SPc 42..285 CDD:214473 75/266 (28%)
Tryp_SPc 43..288 CDD:238113 77/268 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..316
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 327..383
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.