DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and deltaTry

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:257 Identity:93/257 - (36%)
Similarity:132/257 - (51%) Gaps:14/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVIT 74
            ::||..|...||..|.:..... ::.|||||.......||.||||:..|.|.|||.|.|:..::|
  Fly     5 VILLSAVACALGGTVPEGLLPQ-LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68

  Fly    75 AGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFD 138
            |.||::.    |.|.:..|:|||...||.||...|:....|..| |....||:|::::...|||.
  Fly    69 AAHCLQS----VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129

  Fly   139 ANIAAIQLATEDPPNCVAVDISGWGNIA-EKGPLSDSLLFVQVTSISRGACRWMFY---SRLPET 199
            :.|.||.||:.:|.|..|..:||||.:: ....:...|.:|.|..:|:..|....|   |::..|
  Fly   130 STIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194

  Fly   200 MICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEKA 260
            |||...| ...||.||||||...||.:||:.|  .|.||..: .|..|..::.:|:|:...|
  Fly   195 MICAAAS-GKDACQGDSGGPLVSGGVLVGVVS--WGYGCAYSNYPGVYADVAALRSWVISNA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 85/225 (38%)
Tryp_SPc 37..219 CDD:238113 71/186 (38%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 85/225 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.