DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and alphaTry

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:258 Identity:96/258 - (37%)
Similarity:134/258 - (51%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73
            :::||..|...||..|.:..... ::.|||||.......||.||||:..|.|.|||.|.||..::
  Fly     4 IVILLSAVVCALGGTVPEGLLPQ-LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIV 67

  Fly    74 TAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTF 137
            ||.||::.    |.|.:..::|||...||.||...|:....|..| |....||:||:||.|.|:|
  Fly    68 TAAHCLQS----VSASVLQVRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSF 128

  Fly   138 DANIAAIQLATEDPPNCVAVDISGWGNIAE-KGPLSDSLLFVQVTSISRGACRWMFY---SRLPE 198
            .::|.||.|||.:|.|..:..:||||..:. ...:...|.:|.|..:|:..|....|   |::..
  Fly   129 SSSIKAISLATYNPANGASAAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRN 193

  Fly   199 TMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEKA 260
            ||||...| ...||.||||||...||.:||:.|  .|.||..: .|..|..::.:|:|:...|
  Fly   194 TMICAAAS-GKDACQGDSGGPLVSGGVLVGVVS--WGYGCAYSNYPGVYADVAVLRSWVVSTA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 88/225 (39%)
Tryp_SPc 37..219 CDD:238113 74/186 (40%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 88/225 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.