DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP012671

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230557.2 Gene:AgaP_AGAP012671 / 4578478 VectorBaseID:AGAP012671 Length:216 Species:Anopheles gambiae


Alignment Length:219 Identity:64/219 - (29%)
Similarity:99/219 - (45%) Gaps:24/219 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY----- 118
            |:..|..||:..|.:||.||| :.....|..: |:..||....:.||...|..:.:||.|     
Mosquito     7 EYAVGATIITHKHALTAAHCV-YPQRSEPMRV-SLYGGSTSAVTGGVLFSVVRIAVHPGYDHSYF 69

  Fly   119 ATGGHNDLAVLRL-QSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLS-DSLLFVQVT 181
            ......|:|||.: .:..:..:|:|::.|.|.:.|......::|||......|.| :.|.:.::|
Mosquito    70 PDASEYDVAVLTVANNAFSGKSNMASLILQTSEQPIGTRCFVAGWGRTGNNEPASLNQLRYAEMT 134

  Fly   182 SISRGAC--RWMFYSRLPETMICLLHSKNSG----ACYGDSGGPATYGGKVVGLASLLLGGGCGR 240
            .:.:..|  .|..|.|...|      ||..|    .|.|||||....||.:.|:.| .....|..
Mosquito   135 IVDQSTCARAWATYPRQRVT------SKKYGNGVDTCKGDSGGALVCGGGLAGVVS-FTNLECTS 192

  Fly   241 AAPDGYLRIS--KVRAWIAEKAGL 262
            |.|.|:.:||  .:|.:|:.:||:
Mosquito   193 AWPAGFSKISAPSIRRFISTEAGI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/211 (29%)
Tryp_SPc 37..219 CDD:238113 49/172 (28%)
AgaP_AGAP012671XP_001230557.2 Tryp_SPc 11..203 CDD:214473 58/200 (29%)
Tryp_SPc 11..202 CDD:238113 57/199 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.