DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP012502

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230484.2 Gene:AgaP_AGAP012502 / 4578454 VectorBaseID:AGAP012502 Length:829 Species:Anopheles gambiae


Alignment Length:227 Identity:71/227 - (31%)
Similarity:97/227 - (42%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAE-----VIMHPNYATG 121
            |||.:|.|..::||.||.|..:.::|.|:  |:.|.|.|..|.....|.|     ||.||.|.|.
Mosquito    46 CGGSLIWANFILTAAHCTKDRDTLLPPDI--IRIGDLNLYDDREDALVQERTIIRVIRHPLYNTS 108

  Fly   122 G-HNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWG---------NIAEKGPLS---- 172
            . ..|:|:|.|...:.....:....|..:|......|:.:|||         ||..|..|.    
Mosquito   109 SVFYDIALLMLNEKVNIYFEVMPTCLWLDDNIPFSKVEAAGWGTSGFGYGKTNILIKAELKLMAN 173

  Fly   173 ---DSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGACYGDSGGP----ATYGG-KV--- 226
               :| .:.||.|:..|         |.|..:| ...|....|.||||||    ..:|. ||   
Mosquito   174 KDCES-YYSQVASVKNG---------LMEHQLC-AWDKVMDTCPGDSGGPLQHKLIFGDYKVPFL 227

  Fly   227 VGLASLLLGGGCGRAAPDGYLRISKVRAWIAE 258
            ||:.|  .|..||.:.|..|:::||..:||.|
Mosquito   228 VGVTS--FGLSCGNSQPGVYVKVSKFGSWIVE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/223 (30%)
Tryp_SPc 37..219 CDD:238113 53/178 (30%)
AgaP_AGAP012502XP_001230484.2 Tryp_SPc 19..258 CDD:238113 71/227 (31%)
Tryp_SPc 19..255 CDD:214473 68/223 (30%)
Tryp_SPc 325..>418 CDD:304450
Trypsin 621..823 CDD:278516
Tryp_SPc 629..826 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.