DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010015

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001238092.2 Gene:AgaP_AGAP010015 / 4577984 VectorBaseID:AGAP010015 Length:239 Species:Anopheles gambiae


Alignment Length:243 Identity:68/243 - (27%)
Similarity:114/243 - (46%) Gaps:28/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLL 100
            ||:.|:|....::|..:::....:..|.|.||:.:||::..:|.:     :.....||..|....
Mosquito     9 RILNGLKVNPERYPFIVNIYFEDQFLCSGNIITPSHVLSLEYCFE-----IFVFQMSIYGGGTSP 68

  Fly   101 SSDGVRIPVAEVIMHPNYA-TGGHNDLAVLRLQSPL-TFD--ANIAAIQLATED---PPNCVAVD 158
            .|.|:.|||.::.:|||:. ..|.:|..|..:..|: ||.  ||:|:|.|.|.:   ...|..: 
Mosquito    69 LSGGISIPVNKITIHPNFEYRYGRSDFDVAVISVPINTFQGMANMASIALQTSEVLPGSRCYVI- 132

  Fly   159 ISGWGNIAEKGPLS-DSLLFVQVTSISRGACRWMFYS---RLPETMICLLHSKNSGACYGDSGGP 219
              |||.....||:. :.|.:..:..:|:.||...:.|   .:...|||..:......||||.|||
Mosquito   133 --GWGVSKIFGPIDLNGLHYGTMNIVSQSACSRSWASVNENVTSNMICAKYCFGVDICYGDLGGP 195

  Fly   220 ATYGGKVVGLASLLLG---GGCGRAAPDGYLRI--SKVRAWIAEKAGL 262
            ....||:.|    ::|   .||.:..|..:.||  ..:|::|..:.|:
Mosquito   196 LVCDGKLTG----IIGYTEYGCTKNNPAVFTRIMAPSIRSFIRNETGI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/235 (28%)
Tryp_SPc 37..219 CDD:238113 53/192 (28%)
AgaP_AGAP010015XP_001238092.2 Tryp_SPc 9..224 CDD:214473 63/226 (28%)
Tryp_SPc 10..235 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.