DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010798

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001231167.2 Gene:AgaP_AGAP010798 / 4577817 VectorBaseID:AGAP010798 Length:276 Species:Anopheles gambiae


Alignment Length:279 Identity:72/279 - (25%)
Similarity:122/279 - (43%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLC-----------GVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISL-----RL 56
            :|:|::|           .:.:.:..:|:..|..|.   |||.|.:|....:|:.:|:     |:
Mosquito    13 LLVLVVCCLLLYSSRSYLTLSLAVMSEVSAKQKMSF---RIVNGTEATIVSYPYVVSIQRWTPRV 74

  Fly    57 RGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHP--NYA 119
            : :|.|||.:||.:.::||.||.    |.:......::..|...:..|....|.:||.|.  :||
Mosquito    75 K-QHICGGTLISESWILTAAHCA----DKISPTTVMVRVNSSFFNRGGKLHRVEKVIKHERFSYA 134

  Fly   120 TGGHNDLAVLRLQSPLTFDANIAAIQLATEDPP--NCVAVDISGWGNIAEKGPLSDSLLFVQVTS 182
            ||.: |..:|:|:........:...:.....||  .|.|:   |||....: ...:.|..|.:..
Mosquito   135 TGDY-DFGLLKLKQRYRRGTFVKLPERRRRFPPAERCTAM---GWGETLGR-ESREQLRQVVMPI 194

  Fly   183 ISRGACRWMF--YSRLPETMICLLHSKN-SGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPD 244
            :|:..||..:  ...:...|:|..:.:. ..||.||||||....|...|:.|..:  ||.:....
Mosquito   195 VSQAVCRKAYEGTDEITARMLCAGYPEGMRDACDGDSGGPLICRGIQAGVISWAI--GCAQPNKY 257

  Fly   245 G-YLRISKVRAWIAEKAGL 262
            | |..|::.|.||....|:
Mosquito   258 GVYSSIAEGREWIRNHTGV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/232 (27%)
Tryp_SPc 37..219 CDD:238113 51/193 (26%)
AgaP_AGAP010798XP_001231167.2 Tryp_SPc 49..270 CDD:214473 63/232 (27%)
Tryp_SPc 50..273 CDD:238113 64/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.