DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:255 Identity:74/255 - (29%)
Similarity:117/255 - (45%) Gaps:27/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AQNQSE---SAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV-KHGNDV 85
            |:|.:|   :|...||:.|..:....:|..||:|..|:.||||.:|||::.:||...| .:.|.:
Mosquito    36 AENVTEAEAAAQSGRIINGFASDIANYPFAISVRRDGQFYCGGTVISASYALTAATPVYPYRNSI 100

  Fly    86 VPADLWSIQAGSLLLSSDGVRIPVAEVIMH----PNYATGGHNDLAVLRLQSPLTFDA--NIAAI 144
                  ::..||...:|.||...|..:.:|    ||.....:| :|:|.:.:. .|..  |||.|
Mosquito   101 ------TLYGGSTSANSGGVLFKVLMIAVHLLFNPNDRVSDYN-IAILTVPAN-AFGGRRNIAPI 157

  Fly   145 QLATEDPPNCVAVDISGWG--NIAEKGPLSDSLLFVQVTSISRGAC--RWMFYS-RLPETMICLL 204
            .||:.:........:.|||  |....|| :::|....:...|...|  .|...| :|...|||..
Mosquito   158 PLASAEVAIGTKCTVFGWGRTNANLPGP-ANALRSADMVISSGATCARAWGPLSVQLTSNMICAK 221

  Fly   205 HSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRISK--VRAWIAEKAGL 262
            ..:.:..|.||.|......||:.|:| .|...||.......|:||::  :|.:|..:.|:
Mosquito   222 GVRGADLCIGDYGNALVCRGKLNGIA-FLASPGCDNTRDSVYMRITEYNIRRFIRSQTGV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/233 (29%)
Tryp_SPc 37..219 CDD:238113 56/193 (29%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 67/227 (30%)
Tryp_SPc 51..268 CDD:238113 66/226 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.