DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP010620

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230718.2 Gene:AgaP_AGAP010620 / 4577717 VectorBaseID:AGAP010620 Length:262 Species:Anopheles gambiae


Alignment Length:266 Identity:71/266 - (26%)
Similarity:118/266 - (44%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHC 78
            ||:     .::.:..::|.   ||:.|...:..::|..:|||..|:..||..:||.:|.:||...
Mosquito    14 CGL-----SEIPEAAAQSG---RIINGFSVEIAKYPFVLSLRRDGKFDCGATVISLSHALTAAAS 70

  Fly    79 V-KHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNY---ATGGHNDLAVLRLQSPLTFDA 139
            : .:.|.  |..: ::..||...:|.||...|..:.:||||   ......::|||.:.:. .|.|
Mosquito    71 IYPYRNS--PQRM-TLYGGSTSPTSGGVSFSVLRIAVHPNYNPIVRVSDFNIAVLTVPTN-AFRA 131

  Fly   140 --NIAAIQLATEDPPNCVAVDISGWGNIAEKGPL-SDSLLFVQVTSISRGAC--RWMFYSRLP-- 197
              |||.|.||:..........:.|||:.....|. :.:|....:...|...|  .|:   :||  
Mosquito   132 KRNIAPIPLASSVVETGTKCSVFGWGSTNYYIPAPATTLRAADMVISSEATCARAWL---QLPSP 193

  Fly   198 ----ETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRI--SKVRAWI 256
                ..|:|....:.:..|.||||......|::.|:|  :|...||......|.:|  |.||::|
Mosquito   194 VVITSNMVCAKGDRGADLCTGDSGNALVCSGRLTGVA--ILSNTCGNGRDTAYTKITASSVRSFI 256

  Fly   257 AEKAGL 262
            ..:.|:
Mosquito   257 RSQTGV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/236 (28%)
Tryp_SPc 37..219 CDD:238113 54/196 (28%)
AgaP_AGAP010620XP_001230718.2 Tryp_SPc 28..256 CDD:214473 66/236 (28%)
Tryp_SPc 29..259 CDD:238113 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.