DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP012036

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_552175.3 Gene:AgaP_AGAP012036 / 4577673 VectorBaseID:AGAP012036 Length:370 Species:Anopheles gambiae


Alignment Length:240 Identity:60/240 - (25%)
Similarity:95/240 - (39%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGVIISATHVITAGHCVKHGNDVVPADLWSIQA----------GSLLLSSDGVRIP-------- 108
            |.|.:|...:|:||.|||.  |.:|.   :|:|.          |..|:|:.|..:.        
Mosquito   139 CVGTLIQERYVLTAAHCVH--NLIVS---FSLQCLFLRRIKLYFGLFLISTLGQCLADRVCQERR 198

  Fly   109 VAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDI------------- 159
            .||:|:|.:|.:... ||:|::|:..         |:|...:..|.|:..:.             
Mosquito   199 AAELIVHQDYNSHARLNDIALIRVSE---------AVQFTQDVRPACLPFNYLFDESLASPRVLS 254

  Fly   160 SGWGNIAEKGPLSDSLLFVQVTSISRGAC-----RWMFY--SRLPETMICLLHSKNSGACYGDSG 217
            .|||.. ::|.:|||...||:..|....|     :|..:  |.:...|..:........|.||||
Mosquito   255 LGWGEY-QQGTMSDSKRIVQLEIIKEDECGDQLKKWQRFNISMISSVMCTVGVLAGQDVCEGDSG 318

  Fly   218 GPATYGGK----VVGLASLLLGGGCGRAAPDGYL--RISKVRAWI 256
            .|......    |:|:.|  .|..||.......:  |:|:.:.||
Mosquito   319 APIVQIRNDRYFVIGVVS--FGPKCGMGTGTAGMSTRVSEYKNWI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 58/238 (24%)
Tryp_SPc 37..219 CDD:238113 49/195 (25%)
AgaP_AGAP012036XP_552175.3 CLIP 28..83 CDD:288855
Tryp_SPc 122..361 CDD:214473 58/238 (24%)
Tryp_SPc 122..361 CDD:238113 58/238 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.