DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP001248

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001238557.2 Gene:AgaP_AGAP001248 / 4577294 VectorBaseID:AGAP001248 Length:271 Species:Anopheles gambiae


Alignment Length:236 Identity:75/236 - (31%)
Similarity:116/236 - (49%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV---KHGNDVVPADLWSIQAGS 97
            |||||..|...::|...|||....|.|...|||..|..|..||.   |..:.|      :|.|||
Mosquito    42 RIVGGSTATIARYPFVASLRRFSNHICTASIISTLHAATGAHCTYSFKSLSGV------TIYAGS 100

  Fly    98 LLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQL--ATEDPPNCVAVDI 159
            ...::.|....|.:..:||.|.....: |:||||:::|.|.:.|||::.|  |....|:.|...:
Mosquito   101 TSRTTGGRVFVVTDNFIHPKYDPDTFDFDVAVLRVKTPFTPNMNIASVPLVPANYAVPDKVQPTV 165

  Fly   160 SGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY-SRLPETMICLLHSKNSGACYGDSGG----P 219
            :|||..:..|.||.:|..|.:..|....|:.::. :.:.:.|:| ..:|...||.|||||    |
Mosquito   166 AGWGRTSTGGTLSPTLRAVAIPVIGNIPCQELWIDTDITDNMLC-AGAKGRDACTGDSGGPLVVP 229

  Fly   220 ATYGGKVVGLASLLLGGGCGRAAPDGYLRIS--KVRAWIAE 258
            .|...::||:.| .....||...|..|.|::  .:::::|:
Mosquito   230 TTNYFQLVGIVS-WGSAACGSEYPGVYTRMASPSIQSFLAQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 74/232 (32%)
Tryp_SPc 37..219 CDD:238113 63/192 (33%)
AgaP_AGAP001248XP_001238557.2 Tryp_SPc 42..260 CDD:214473 74/225 (33%)
Tryp_SPc 43..257 CDD:238113 72/221 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.