DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004569

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001237553.3 Gene:AgaP_AGAP004569 / 4577070 VectorBaseID:AGAP004569 Length:296 Species:Anopheles gambiae


Alignment Length:292 Identity:86/292 - (29%)
Similarity:121/292 - (41%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWTTLWTVLLLLLCGVQVILGQDVAQNQSES--------AIEPRIVGGIKAKQGQFPHQISLRLR 57
            :|..:.|.|.:.|....|       .|.|||        ....|||||.:|...|||....|..:
Mosquito    14 IWVLMLTTLAVPLLAAPV-------YNSSESCDCVCGVGGRTNRIVGGSEAAAHQFPWLAGLFRQ 71

  Fly    58 GEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIP--------VAEVIM 114
            |:.|||..::|...::||.|||.           |.:|..:.:...|..|.        |..:|.
Mosquito    72 GKLYCGASVVSRNFLVTAAHCVN-----------SFEASEIRVYLGGHNIAKDYTELRRVKRIID 125

  Fly   115 HPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVD-------ISGWGNIAEKGPL 171
            |.:: ....:||:|:|.|..||.:...|....|     |:...:|       ::|||.:.||...
Mosquito   126 HEDFDIFTFNNDIALLELDKPLRYGPTIQPACL-----PDGSVMDFTGTIGVVAGWGRVEEKRAP 185

  Fly   172 SDSLLFVQVTSISRGACRWMFY--SRLPETMICL-LHSKNSGACYGDSGGP----ATYGG-KVVG 228
            |.:|..|:|...|:..|....|  .::...|:|. .|.....||.||||||    ..:|. :|:|
Mosquito   186 SKTLRSVEVPIWSQEQCLDAGYGSKKISANMMCAGYHDGQKDACQGDSGGPMHKMGLFGSMEVIG 250

  Fly   229 LASLLLGGGCGRA-APDGYLRISKVRAWIAEK 259
            :.|  .|.||.|. .|..|.||.....||.||
Mosquito   251 VVS--WGRGCARPNLPGIYTRIVNYLPWIHEK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/244 (30%)
Tryp_SPc 37..219 CDD:238113 58/200 (29%)
AgaP_AGAP004569XP_001237553.3 Tryp_SPc 50..277 CDD:214473 73/244 (30%)
Tryp_SPc 51..280 CDD:238113 74/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.