DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP004571

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_313875.2 Gene:AgaP_AGAP004571 / 4576898 VectorBaseID:AGAP004571 Length:324 Species:Anopheles gambiae


Alignment Length:258 Identity:74/258 - (28%)
Similarity:105/258 - (40%) Gaps:56/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLW---SIQAGS 97
            |||||......:||....|......||||::|:..:|:||.||||       ..:|   .:..|.
Mosquito    82 RIVGGQATGVNEFPWMARLSYFNRFYCGGMLINDRYVLTAAHCVK-------GFMWFMIKVTFGE 139

  Fly    98 LLLSSDGVRIPVAEVIMHPNYATGGHNDLAVLRLQSPLTFDANIAAIQLATEDP------PNCVA 156
            .....|.|| |....::.           |:.:..|.|.||.:||.::|....|      |.|:.
Mosquito   140 HNRCDDSVR-PETRFVLR-----------AIAQKFSFLNFDNDIALLRLNDRVPITDFIRPICLP 192

  Fly   157 VDIS-----------GWGNIAEKGPLSDSLLFVQVTSISRGACRWM---FYSRLPETMIC--LLH 205
            .|.|           |||.:.|.|..|..|..|:|..:|...|...   ..|.:.:.|:|  .|.
Mosquito   193 SDPSNAYVGTNGTATGWGTLKEDGKPSCILQEVEVPVLSNEVCSTQTNYTASMITDNMLCAGYLG 257

  Fly   206 SKNSGACYGDSGGP-------ATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAEKA 260
            .....:|.||||||       ..|  :::|:.|  .|.||.|. .|..|.|:::...||.|.:
Mosquito   258 VGEKDSCQGDSGGPLIAEREDKRY--ELIGVVS--WGNGCARPYYPGVYTRVTRYLDWIRENS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/252 (28%)
Tryp_SPc 37..219 CDD:238113 58/206 (28%)
AgaP_AGAP004571XP_313875.2 Tryp_SPc 82..312 CDD:214473 71/252 (28%)
Tryp_SPc 83..315 CDD:238113 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.