DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006675

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001237857.2 Gene:AgaP_AGAP006675 / 4576700 VectorBaseID:AGAP006675 Length:302 Species:Anopheles gambiae


Alignment Length:257 Identity:82/257 - (31%)
Similarity:120/257 - (46%) Gaps:47/257 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLR---LRGEHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            |||.|.:|..||||:||:|.   ..|...|||.||:.|.::||.|||..|            ||:
Mosquito    55 RIVNGQEAVPGQFPYQIALLSNFAAGGGLCGGTIITNTFILTAAHCVVDG------------AGA 107

  Fly    98 LLLSSDGVRI----------PVAE--------VIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAA 143
              |::||..|          |..:        |.:||:| ||...||:|.:||.||..|:..:..
Mosquito   108 --LATDGTAILGAHNRTATEPTQQRIGFVRDGVFVHPSYSATLIRNDIATVRLNSPAVFNERVQP 170

  Fly   144 IQLATEDPPNCVAVDI---SGWGNIAEKGP-LSDSLLFVQVTSISRGAC--RWMFYSRLPETMIC 202
            |:|.........|..|   ||:|..::..| .||.:::.....::..||  .|... .:.:..:|
Mosquito   171 IELPARSDSRTFAGMIGTASGFGRTSDALPGASDVVMYTSNPVMTNAACVSAWNII-LVSDQNVC 234

  Fly   203 LLHSKNSGACYGDSGGPATY--GGK--VVGLASLLLGGGCGRAAPDGYLRISKVRAWIAEKA 260
            |..:.....|.||||||.|.  ||:  .:|:||.:...||....|..::|||..|.:|.:.:
Mosquito   235 LDATGGRSVCNGDSGGPLTVQDGGESLEIGIASFVSAQGCASGIPSVWVRISFYRDFIEQNS 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 81/251 (32%)
Tryp_SPc 37..219 CDD:238113 65/209 (31%)
AgaP_AGAP006675XP_001237857.2 Tryp_SPc 55..292 CDD:214473 81/251 (32%)
Tryp_SPc 56..295 CDD:238113 81/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.