DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP006710

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_565496.1 Gene:AgaP_AGAP006710 / 4576607 VectorBaseID:AGAP006710 Length:258 Species:Anopheles gambiae


Alignment Length:227 Identity:76/227 - (33%)
Similarity:121/227 - (53%) Gaps:14/227 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRG-EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLL 99
            |:|||..||.|..|:|:||::.| .|.|||.:::...|:||.||:. |.:  |:|| .:..|:..
Mosquito    32 RVVGGEVAKNGSAPYQVSLQVPGWGHNCGGSLLNNRWVLTAAHCLV-GYE--PSDL-MVLVGTNS 92

  Fly   100 LSSDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWG 163
            |...|..:.|.:::.|..| ....|||:.::||:.|:.|...:.:::...:..|....|.::|||
Mosquito    93 LKEGGELLKVDKLLYHSRYNRPQFHNDIGLMRLEQPVQFSELVQSVEYLEKAVPVNATVRLTGWG 157

  Fly   164 NIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETM----ICLLHSKNSGACYGDSGGPATYGG 224
            ..:..|.:...|..:.|.::|...|:....:  ||.:    :|.|.....|||.||||||..|.|
Mosquito   158 RTSTNGNVPTLLQSLNVVTLSNEDCKAKMGN--PENVDLGHVCTLTKAGEGACNGDSGGPLVYEG 220

  Fly   225 KVVGLASLLLGGGCGRAAPDGYLRISKVRAWI 256
            |:||:.:  .|..|||..|||:.|:|....|:
Mosquito   221 KLVGVVN--FGVPCGRGFPDGFARVSYYHEWV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/225 (33%)
Tryp_SPc 37..219 CDD:238113 58/187 (31%)
AgaP_AGAP006710XP_565496.1 Tryp_SPc 32..250 CDD:214473 75/225 (33%)
Tryp_SPc 33..253 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.