DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP000411

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001237291.3 Gene:AgaP_AGAP000411 / 4576124 VectorBaseID:AGAP000411 Length:1091 Species:Anopheles gambiae


Alignment Length:246 Identity:63/246 - (25%)
Similarity:110/246 - (44%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IVGGIKAKQGQFP-HQISLRLRGEH---YCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGS 97
            |..|..|..|.:| |......:.:|   .|||.|:..|.::||.|||...:.|:.|.|.::..|.
Mosquito    23 IHNGADAIAGHWPWHAAIFHQKDKHKEYACGGSILDETTILTASHCVSTLSGVISAALVTVHVGQ 87

  Fly    98 LLL--SSDGVR-IPVAEVIMHPNYATGG-HNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAV- 157
            :.|  ||:..: ....|:|::|.::... .:|:|:::|::.::.:..:..:.|.|.|....:.| 
Mosquito    88 IHLNQSSEYTQTFEAREIIINPGFSKASIIHDIALIKLRTNISMNRYVQPVCLWTMDSALELIVG 152

  Fly   158 ---DISGWGNIAEKGPLSDSLLFVQVTSISRGAC----RWMFYSRLPETMICLLHSKNSGACYGD 215
               .|.|:| ::|:..:|:.|....:..:....|    |.::.:.|...|.|........||.||
Mosquito   153 RNGTIVGFG-LSERDVVSEQLKQATIGVVDPYTCIASDRVVYGTHLTLEMFCGKGQNGVSACNGD 216

  Fly   216 SGGPATY--GGK--VVGLASLLLGGG----CGRAAPDGYLRISKVRAWIAE 258
            |||...:  .|:  |.||.|.....|    |.......|..::|...||.:
Mosquito   217 SGGGMFFEVSGRWFVRGLVSFTPARGSSGLCDPLKYTVYTDVAKYVEWIKQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 61/242 (25%)
Tryp_SPc 37..219 CDD:238113 51/197 (26%)
AgaP_AGAP000411XP_001237291.3 Tryp_SPc 23..267 CDD:238113 63/244 (26%)
Tryp_SPc 25..265 CDD:214473 60/240 (25%)
Tryp_SPc 308..>462 CDD:304450
Trypsin 838..1069 CDD:278516
Tryp_SPc 864..>946 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.