DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP012778

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230340.2 Gene:AgaP_AGAP012778 / 4397620 VectorBaseID:AGAP012778 Length:276 Species:Anopheles gambiae


Alignment Length:241 Identity:73/241 - (30%)
Similarity:100/241 - (41%) Gaps:33/241 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRG--EHYCGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSL 98
            ||:||.......:...:...:.|  .::|||.:|....|:||.|||.:..    :....:..|..
Mosquito    42 RIIGGSAVTAPSWMVAVGEVVNGNWSNFCGGTLIDKQWVLTAAHCVANAQ----SGPMEVAIGVS 102

  Fly    99 LLSSDGVRIPVAEVIMHPNY-----------ATGGHNDLAVLRLQSPLTFDANIAAIQLATED-- 150
            .||....|..|.:|:|||.|           .|...:|:|:|.|.:|:| .|.|....:.|:|  
Mosquito   103 DLSRPHTRSKVDQVLMHPEYYVNLLSNLGYRETPYSSDVALLHLATPVT-QAPIVMADITTKDTW 166

  Fly   151 PPNCVAVDISGWGNI---AEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNSGAC 212
            ..|...:...|:|.|   |.|.  |..||.|.:.  .||. |..:|.....|.|..........|
Mosquito   167 QWNTTMLHAIGYGGINPDATKS--SPQLLAVDLA--YRGE-RDYWYGDPTTTHIFAGKLAGQDTC 226

  Fly   213 YGDSGGPATYGGKVVGLASLLLGGG--CGRAAPDGYLRISKVRAWI 256
            .||||||.|||||:||:.|.   |.  |...:..||........||
Mosquito   227 KGDSGGPLTYGGKLVGVTSY---GAFPCATGSAGGYTYAPAFSDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 71/239 (30%)
Tryp_SPc 37..219 CDD:238113 56/199 (28%)
AgaP_AGAP012778XP_001230340.2 Tryp_SPc 42..269 CDD:214473 71/239 (30%)
Tryp_SPc 43..269 CDD:238113 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.