DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP012842

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230353.1 Gene:AgaP_AGAP012842 / 4397614 VectorBaseID:AGAP012842 Length:110 Species:Anopheles gambiae


Alignment Length:110 Identity:33/110 - (30%)
Similarity:50/110 - (45%) Gaps:9/110 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 ISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMF---YSRLPETMICLLHSKNSG--ACYGDSGG 218
            :||||........:|.|....|.::::..|...:   |..:.:.|.|..: |..|  .|..||||
Mosquito     4 VSGWGLTLSDADSNDVLRATNVPTVNQQECNKAYQSMYGGITDQMFCAGY-KQGGQDTCRQDSGG 67

  Fly   219 PATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAEKAGL 262
            |....||::|:.|  .|..|..|. |..|.|::..|.||...:|:
Mosquito    68 PFVAEGKLIGVIS--WGHECALAGYPGVYARVASARDWIRATSGV 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 30/102 (29%)
Tryp_SPc 37..219 CDD:238113 17/64 (27%)
AgaP_AGAP012842XP_001230353.1 Tryp_SPc <1..107 CDD:238113 32/105 (30%)
Tryp_SPc <1..104 CDD:214473 30/102 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.