DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and AgaP_AGAP012491

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_001230277.2 Gene:AgaP_AGAP012491 / 4397584 VectorBaseID:AGAP012491 Length:272 Species:Anopheles gambiae


Alignment Length:273 Identity:80/273 - (29%)
Similarity:128/273 - (46%) Gaps:26/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVIL---GQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISA 69
            ||..|.||..|:.   ||:..:..|.|.   |||.||......:.:.:|:|..||..||..||:.
Mosquito     8 VLFGLFCGNAVVTNANGQNTTEGPSHSG---RIVNGIPVNISNYKYALSMRFDGEFICGASIITY 69

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHN-----DLAVL 129
            :|.:||.|||.  |....:...::..||...||.||..||....:||.|.....:     |:|:|
Mosquito    70 SHALTAAHCVY--NYQFMSSRLTLYGGSTSASSGGVEFPVVGGAIHPYYKPNSQSNTSDYDVAIL 132

  Fly   130 RLQSPLTFDA--NIAAIQLATEDPPNCVAVDISGWGNIAEKGPLS-DSLLFVQVTSISRGAC--R 189
            .:.:. :|..  |:|.:.|.|::.|......:.|||...|..|:| :.||:..:..:|:.:|  .
Mosquito   133 NVPAN-SFSGRPNMAPLALQTKELPVGTRCFVVGWGRTGENQPVSTNQLLYANMNIVSQSSCASM 196

  Fly   190 WMFYSRL---PETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRIS- 250
            |..:.:|   .:.|:|..:......|.|||||....||::.|:.|  .|..|....|..:.::: 
Mosquito   197 WANFEKLCAECKHMVCAQYYNGMDTCRGDSGGALVCGGRLTGVVS--FGPYCSGVWPSVFAKVTA 259

  Fly   251 -KVRAWIAEKAGL 262
             .:|::|....|:
Mosquito   260 PSMRSFIQLYTGI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/234 (29%)
Tryp_SPc 37..219 CDD:238113 58/194 (30%)
AgaP_AGAP012491XP_001230277.2 Tryp_SPc 36..266 CDD:214473 68/234 (29%)
Tryp_SPc 37..267 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.