DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG34130

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:229 Identity:51/229 - (22%)
Similarity:101/229 - (44%) Gaps:22/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GIKAKQGQFPHQISLRLR---GEHY-CGGVIISATHVITAGHCV-KHGNDVVPADLWSIQAGS-- 97
            ||:...|  .|.:...||   |..: ||...:||.:.:|:.:|: .|.:.:....:..:.:.|  
  Fly    45 GIRRTSG--GHAVPWLLRIVDGPTFVCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSRQ 107

  Fly    98 --LLLSSDGVRIPVAEVIMHPNYA-TGGHNDLAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDI 159
              .|.|.|.....:..:|:..::. .|...|:||:.|.:.|..:.| ..:.|.|....:..::.:
  Fly   108 DNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRN-NYVTLCTNPLSSYKSLSV 171

  Fly   160 SGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYS-RLPETMICLLHSKNSGACYGDSGGPATYG 223
            ..:|    .|| ::::...::..::|..|...:.: .|.||:.|....|.|..|...:|.|.|.|
  Fly   172 VSYG----AGP-AENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSADCMFSAGCPVTAG 231

  Fly   224 GKVVGLASLLLGGGCGRA-APDGYLRISKVRAWI 256
            .::.|:.:  ....|.|: .|..:..|.:|:.:|
  Fly   232 DQLCGIVA--WSPACKRSNLPGIFTDIHQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 50/227 (22%)
Tryp_SPc 37..219 CDD:238113 41/189 (22%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 47/217 (22%)
Tryp_SPc 53..256 CDD:304450 45/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.