DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and zgc:92313

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001002596.1 Gene:zgc:92313 / 436869 ZFINID:ZDB-GENE-040718-339 Length:309 Species:Danio rerio


Alignment Length:286 Identity:83/286 - (29%)
Similarity:124/286 - (43%) Gaps:48/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WTVLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR-LRGEHYCGGVIISA 69
            | ::|::|.|:.|  |:  ||......:..|||||..|..|.:|.|:.:: .:.:|.|||.|||.
Zfish     9 W-IVLVVLNGLWV--GE--AQECGRPPMINRIVGGSSAADGAWPWQVDIQGEKSKHVCGGTIISE 68

  Fly    70 THVITAGHCVKHGNDVVPADLWSIQAGSLLLSS---DGVRIPVAEVIMHPNYA---TGGHNDLAV 128
            ..|::|.||..:.||:   ..:.|.||...|:.   |.....::.|::...|.   .|  .|:|:
Zfish    69 NWVLSAAHCFPNPNDI---SGYLIYAGRQQLNGWNPDETSHRISRVVVPLGYTDPQLG--QDIAL 128

  Fly   129 LRLQSPLTFDANIAAIQLA------TEDPPNCVAVDISGWGNIAE------KGPLSDSLLFVQVT 181
            :.|.:|..:...|..:.|.      |.| ..|:   |:|||:|.|      .|||.:    |||.
Zfish   129 VELATPFVYTERIQPVCLPYANVEFTSD-MRCM---ITGWGDIREGVALQGVGPLQE----VQVP 185

  Fly   182 SISRGACRWMFYSR-------LPETMICLLHSKNSGACYGDSGGPAT---YGGKVVGLASLLLGG 236
            .|....|:.||.:.       .|:.|..........:|.||||||..   ..|..|....:..|.
Zfish   186 IIDSQICQDMFLTNPTENIDIRPDMMCAGFQQGGKDSCQGDSGGPLACQISDGSWVQAGIVSFGL 250

  Fly   237 GCGRA-APDGYLRISKVRAWIAEKAG 261
            ||..| .|..|.::|....:|....|
Zfish   251 GCAEANRPGVYAKVSSFTNFIQTHVG 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/249 (29%)
Tryp_SPc 37..219 CDD:238113 61/207 (29%)
zgc:92313NP_001002596.1 Tryp_SPc 34..271 CDD:214473 73/249 (29%)
Tryp_SPc 35..274 CDD:238113 73/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587802
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.