DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Gm5771

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:266 Identity:76/266 - (28%)
Similarity:118/266 - (44%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHV 72
            :|.|.|.|..|....|          :.:||||...::...|:|:||. .|.|:|||.:|:...|
Mouse     4 LLFLALVGAAVAFPVD----------DDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSLINDQWV 57

  Fly    73 ITAGHCVK---------HGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGG-HNDLA 127
            ::|.||.|         |...|:..:...:.|              |::|.|||:.... :||:.
Mouse    58 VSAAHCYKTRIQVRLGEHNIKVLEGNEQFVNA--------------AKIIKHPNFNRKTLNNDIM 108

  Fly   128 VLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWM 191
            :::|.||:|.:|.:|.:.|.:...|......||||||....|.....|| .:....:.:..|...
Mouse   109 LIKLSSPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEAS 173

  Fly   192 FYSRLPETMIC---LLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKV 252
            :..::...|:|   |...|:|  |.||||||....|::.|:.|  .|.||..| .|..|.::...
Mouse   174 YPGKITGNMVCAGFLEGGKDS--CQGDSGGPVVCNGELQGIVS--WGYGCALADNPGVYTKVCNY 234

  Fly   253 RAWIAE 258
            ..||.:
Mouse   235 VDWIQD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/234 (29%)
Tryp_SPc 37..219 CDD:238113 57/195 (29%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 68/234 (29%)
Tryp_SPc 23..241 CDD:238113 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.