DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG11313

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:279 Identity:76/279 - (27%)
Similarity:118/279 - (42%) Gaps:57/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLR---GEH---YCGGVIISATHVITAGH 77
            |.|.|:|.||        |..|.:....:|...:.|..|   |:.   ||.|.:|:..:|:||.|
  Fly   106 ICGGDIAYNQ--------ITKGNETVLTEFAWMVLLEYRPHDGQQLRTYCAGSLINNRYVVTAAH 162

  Fly    78 CVKHGNDVVPADL---WSIQAGSLLLSS-----------DGVRIPVAEVIMHPNYATG-GHNDLA 127
            ||.........|:   .|::.|....|:           :.|:|.|.|:.:|.::.|. ..||:|
  Fly   163 CVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIA 227

  Fly   128 VLRLQSPLTFDANIAAIQLATEDPPNCV---------AVDISGWGN--IAEKGPLSDSLLFVQVT 181
            ::||...:.:..:|..:.|     |:.|         |..::|||.  .:|..|:...|   :||
  Fly   228 LIRLAREVAYSPSIRPVCL-----PSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKL---RVT 284

  Fly   182 SISRGACRWMFYS--RLPETMICLLHSKNSGACYGDSGGP--ATYGGKVV--GLASLLLGGGCG- 239
            .:..|.||..:.|  .|.::.:|........:|.||||||  |.:.|..|  |:.|  .|..|| 
  Fly   285 YVEPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVS--FGLNCGS 347

  Fly   240 RAAPDGYLRISKVRAWIAE 258
            |..|..|..:.....||.:
  Fly   348 RFWPAVYTNVLSYETWITQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 68/258 (26%)
Tryp_SPc 37..219 CDD:238113 55/215 (26%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 70/261 (27%)
Tryp_SPc 116..364 CDD:214473 68/257 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.