DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG9737

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:276 Identity:72/276 - (26%)
Similarity:108/276 - (39%) Gaps:55/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHY-CGGVIISATHVITAGHCV----------- 79
            |:....:..||.||..|:..:||....|......| |.|.:|...|::||.|||           
  Fly   140 NECGKQVTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGL 204

  Fly    80 KH---GNDVVPADLWSIQAGSLLLSSD-GVRIPVAEVIMHPNY---ATGGHNDLAVLRLQSPLTF 137
            ||   |...|..:...|:..:.|..:| .:.|...::.:||.|   :...:||:|::||:.|::|
  Fly   205 KHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSF 269

  Fly   138 DANIAAIQLATEDPPNCVA----VDISGWGN--------IAEKGPLSDSLLFVQVTSISRGACRW 190
            ...:..|.|..:..|..:|    ..:||||.        |....|:.   |.:::..:|...|..
  Fly   270 THFVMPICLPNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIK---LKLRIPYVSNENCTK 331

  Fly   191 M---FYSRLPETMICLLHSKNSGACYGDSGGP-----------ATYGGKVVGLASLLLGGGCGRA 241
            :   |..||....||.........|.||||||           ..||....|...      ||.|
  Fly   332 ILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQ------CGMA 390

  Fly   242 A-PDGYLRISKVRAWI 256
            . |..|..:::...||
  Fly   391 GKPAVYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/265 (26%)
Tryp_SPc 37..219 CDD:238113 58/215 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 69/265 (26%)
Tryp_SPc 150..409 CDD:238113 70/266 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.