DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and intr

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:213 Identity:48/213 - (22%)
Similarity:77/213 - (36%) Gaps:60/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 CGGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGHNDL 126
            |.|.:||...|:|:..|........|...:.:||....:.|      ||.:|      ||...|:
  Fly   113 CSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRIYS------VANLI------TGAIEDM 165

  Fly   127 AVLRLQSPLTFDANIAAIQLATEDP---PNCVAVDISGWGNIAEKGPL-----------SDSLLF 177
            |:|.|.:||             |||   |    :|:.       :.||           ...|.|
  Fly   166 ALLLLHAPL-------------EDPFVHP----IDLC-------ESPLRRNDNVTMYMSQQHLRF 206

  Fly   178 VQVTSISRGACRWMFYSR-----LPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGG 237
            ::...|....|: ..|::     :.:||:|.|:|.....|....|....:..::.|:.  :.|..
  Fly   207 LRTKLIPNSNCK-RSYAQDENAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGVD--IYGQH 268

  Fly   238 CGRAAPDG--YLRISKVR 253
            |.....:|  |..:.|.|
  Fly   269 CSDGGVNGELYADVFKAR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 48/213 (23%)
Tryp_SPc 37..219 CDD:238113 41/175 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 46/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.