DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and Tmprss9

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:269 Identity:93/269 - (34%)
Similarity:131/269 - (48%) Gaps:33/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 CGVQVILGQDVAQNQSESAIEP------RIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHV 72
            |..:|....:..:.|.:...:|      |||||::|..|:||.|:|||...||:||..||.|..:
Mouse   427 CDDRVDCSDESDEAQCDCGWQPAWRSAGRIVGGVEAAPGEFPWQVSLRENHEHFCGATIIGARWL 491

  Fly    73 ITAGHCVKHGNDVVPADLWSIQAGSLLLS---SDGVRIPVAEVIMHPNY-ATGGHNDLAVLRLQS 133
            ::|.||.....|  ||. |:.||||:.||   :..||..|..:..||.| |.....|:|||.|..
Mouse   492 VSAAHCFNEFQD--PAQ-WAAQAGSVHLSGSEASAVRTRVLRIAKHPAYDADTADFDVAVLELAR 553

  Fly   134 PLTFDANI--AAIQLATE-DPP--NCVAVDISGWGNIAEKGPLSDSLL-FVQVTSISRGACRWMF 192
            ||.|...:  |.:..||. .||  .|:   |||||.:.|...:...:| ...|..:.:..|..::
Mouse   554 PLPFGRYVQPACLPAATHVFPPGKKCL---ISGWGYLKEDFLVKPEVLQKATVELLDQSLCSSLY 615

  Fly   193 YSRLPETMIC--LLHSKNSGACYGDSGGPATY---GGK--VVGLASLLLGGGCGRA-APDGYLRI 249
            ...|.:.|:|  .|..| ..:|.||||||...   .|:  :.|:.|  .|.||..| .|..|.|:
Mouse   616 GHSLTDRMVCAGYLDGK-VDSCQGDSGGPLVCEEPSGRFFLAGIVS--WGIGCAEARRPGVYTRV 677

  Fly   250 SKVRAWIAE 258
            :::|.||.|
Mouse   678 TRLRDWILE 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 86/237 (36%)
Tryp_SPc 37..219 CDD:238113 72/193 (37%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060 2/14 (14%)
Tryp_SPc 455..684 CDD:214473 86/237 (36%)
Tryp_SPc 756..984 CDD:214473
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.