DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG11836

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:246 Identity:76/246 - (30%)
Similarity:114/246 - (46%) Gaps:40/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCVK-------------HGNDV 85
            |.|||||......|:|....:...|:.:|||.:::..:|::|.||||             |..::
  Fly    94 EIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEI 158

  Fly    86 VPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTFDANIAAIQLA-- 147
            ..             .|..::..|..||.|.::....: ||:|:|||:.|::|...|..|.|.  
  Fly   159 TS-------------ESQAIQRAVTAVIKHKSFDPDTYNNDIALLRLRKPISFSKIIKPICLPRY 210

  Fly   148 TEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY--SRLPETMICLLHSKNSG 210
            ..||...:.. :.|||..:|.|.|...:..|:|..:|...||...|  :|:..:|:| ....:..
  Fly   211 NYDPAGRIGT-VVGWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLC-AGRPSMD 273

  Fly   211 ACYGDSGGP--ATYGGK--VVGLASLLLGGGCGRAA-PDGYLRISKVRAWI 256
            :|.||||||  .:.|.|  :||:.|  .|.||||.. |..|.|:||...||
  Fly   274 SCQGDSGGPLLLSNGVKYFIVGIVS--WGVGCGREGYPGVYSRVSKFIPWI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 73/242 (30%)
Tryp_SPc 37..219 CDD:238113 55/199 (28%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.