DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and SPE

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651168.1 Gene:SPE / 42791 FlyBaseID:FBgn0039102 Length:400 Species:Drosophila melanogaster


Alignment Length:284 Identity:79/284 - (27%)
Similarity:124/284 - (43%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISL---RLRGEHY---CGGVIISATHVITAG 76
            |:.|.||.    ......||.||......:||..:.|   :|..|.|   |||.::::.:|:|||
  Fly   120 VLPGNDVC----GFLFADRIFGGTNTTLWEFPWMVLLQYKKLFSETYTFNCGGALLNSRYVLTAG 180

  Fly    77 HCVKHGN-DVVPADLWSIQAGSLLLSSD--------GVR--------IPVAEVIMHPNYATGG-- 122
            ||:.... |...|.|.|::.|.....:|        |.|        |.|.:.|:|..||...  
  Fly   181 HCLASRELDKSGAVLHSVRLGEWDTRTDPDCTTQMNGQRICAPKHIDIEVEKGIIHEMYAPNSVD 245

  Fly   123 -HNDLAVLRLQSPLTFDANIAAIQLATED--PPNCV--AVDISGWGNIAEKGPLSDSL-LFVQVT 181
             .||:|::||:..:::...:..|.|.|:.  ..|.|  .:|::|||......|.:..| :.|.|.
  Fly   246 QRNDIALVRLKRIVSYTDYVRPICLPTDGLVQNNFVDYGMDVAGWGLTENMQPSAIKLKITVNVW 310

  Fly   182 SISRGACRWMFYS---RLPETMICLLHSKNSGACYGDSGGP-----ATYGGKVVGLASLLLGG-- 236
            :::  :|:..:.|   :|.::.:|.........|.||||||     :|.|..|..:|.:...|  
  Fly   311 NLT--SCQEKYSSFKVKLDDSQMCAGGQLGVDTCGGDSGGPLMVPISTGGRDVFYIAGVTSYGTK 373

  Fly   237 GCG-RAAPDGYLRISKVRAWIAEK 259
            .|| :..|..|.|......||.:|
  Fly   374 PCGLKGWPGVYTRTGAFIDWIKQK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/261 (28%)
Tryp_SPc 37..219 CDD:238113 59/215 (27%)
SPENP_651168.1 CLIP 42..94 CDD:314844
Tryp_SPc 135..397 CDD:238113 73/263 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.