DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG7432

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650825.2 Gene:CG7432 / 42347 FlyBaseID:FBgn0038727 Length:721 Species:Drosophila melanogaster


Alignment Length:244 Identity:71/244 - (29%)
Similarity:107/244 - (43%) Gaps:21/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVGGIKAKQGQFPHQISLRLRG----EHYCGGVIISATHVITAGHCVKHGND-VVPADLWSIQA 95
            |||||::|..||:|...::.|.|    |.:|||.:|...:::||.||.:.... ...|..::::.
  Fly   474 RIVGGVEAPNGQWPWMAAIFLHGPKRTEFWCGGSLIGTKYILTAAHCTRDSRQKPFAARQFTVRL 538

  Fly    96 GSLLLS-----SDGVRIPVAEVIMHPNYA-TGGHNDLAVLRLQSPLTFDANIAAIQL--ATEDPP 152
            |.:.||     ||.|...|.||..|..:: .|.:||:|:|.|..|:.....:..:.|  ....||
  Fly   539 GDIDLSTDAEPSDPVTFAVKEVRTHERFSRIGFYNDIAILVLDKPVRKSKYVIPVCLPKGIRMPP 603

  Fly   153 N----CVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFYSRLPETMICLLHSKNS-GAC 212
            .    .....:.|||.....|..|.|....::.......|...::..:.|..||..:|... .||
  Fly   604 KERLPGRRATVVGWGTTYYGGKESTSQRQAELPIWRNEDCDRSYFQPINENFICAGYSDGGVDAC 668

  Fly   213 YGDSGGP--ATYGGKVVGLASLLLGGGCGRAA-PDGYLRISKVRAWIAE 258
            .||||||  ..|....|.|..:..|..||... |..|.|:::...||.:
  Fly   669 QGDSGGPLMMRYDSHWVQLGVVSFGNKCGEPGYPGVYTRVTEYLDWIRD 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 69/240 (29%)
Tryp_SPc 37..219 CDD:238113 57/199 (29%)
CG7432NP_650825.2 CLIP 335..378 CDD:197829
Tryp_SPc 474..715 CDD:214473 69/240 (29%)
Tryp_SPc 475..718 CDD:238113 70/243 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.