DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG5255

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:121/257 - (47%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLLLLL--------CGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLR--LRGEHYC 62
            :||:||        ...|::......:|        |||||.:|..|..|:||||:  ..|.|.|
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKN--------RIVGGEEAAAGLAPYQISLQGIGSGAHSC 57

  Fly    63 GGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAE-VIMHPNYATGGH-ND 125
            ||.||....:|||.||.: |..   |..:.:..|:..|..:|.:....: ::.|.|||...: ||
  Fly    58 GGAIIDERWIITAAHCTR-GRQ---ATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRND 118

  Fly   126 LAVLRLQSPLTFDANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRW 190
            :|:|.|...:.||.....::|..|.......:.::|||.::..|.:...|..::|..:....||.
  Fly   119 IALLHLNESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRA 183

  Fly   191 MF--YSRLPETMICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRAAPDGYLRIS 250
            ..  .:|:....:|..:.|..|||:||||||..:.||:|.|.:  .|..|.:..||.:..||
  Fly   184 AHDNSTRVDIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVN--WGLPCAKGYPDAHASIS 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 72/221 (33%)
Tryp_SPc 37..219 CDD:238113 59/187 (32%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 72/221 (33%)
Tryp_SPc 30..252 CDD:238113 71/220 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.