DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG5246

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:281 Identity:75/281 - (26%)
Similarity:123/281 - (43%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLCGVQVILGQDVAQ----------NQSESAIEP--RIVGGIKAKQGQFPHQIS-LRLRGEHYC 62
            |:|..|.|||.|..|:          |.....::|  |::||:.:..|..|:|:| :...|||.|
  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVC 68

  Fly    63 GGVIISATHVITAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIM----------HPN 117
            ||.||:...::||.||::          |.||...::..:.....|.||.::          .|.
  Fly    69 GGSIIAPQWILTAAHCME----------WPIQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPA 123

  Fly   118 YATGGHNDLAVLRLQSPLTFDANIAAIQLATED--PPNCVAVDISGWGNIAEKGPLSDSLLFVQV 180
            |    |||:|::....|:.:|.....|:||::.  |.....:.::|||:....|..|..|..:.:
  Fly   124 Y----HNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDL 184

  Fly   181 TSISRGACR-------WMFYSRLPETMICLLHSKNSGACYGDSGGPATYGGK-VVGLASLLLGGG 237
            ..|....|:       |     |.|..:|....:..|:|:||||||.....: :||:.:  .|..
  Fly   185 NYIDHDNCQSRVRNANW-----LSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVN--WGEA 242

  Fly   238 CGRAAPDGYLRISKVRAWIAE 258
            |....||.:..::....||.:
  Fly   243 CAIGYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 63/240 (26%)
Tryp_SPc 37..219 CDD:238113 54/201 (27%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 63/240 (26%)
Tryp_SPc 42..263 CDD:238113 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.