DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32523 and CG31266

DIOPT Version :9

Sequence 1:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:287 Identity:76/287 - (26%)
Similarity:126/287 - (43%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTLWTVLLLLLCGVQVILGQ-----------------DVAQNQSESAI-EPRIVGGIKAKQGQFP 49
            |..|.:.:||  |:.::..|                 ::.:::|..|: :.|::||..|.:|.:|
  Fly     2 TNRWNLTVLL--GLTLLALQGPTEAMRMRGEPLPGLANIERHRSTEAVPQGRVIGGTTAAEGNWP 64

  Fly    50 HQISLR-LRGEHYCGGVIISATHVITAGHCV---KHGNDVV---PADLWSIQAGSLLLSSDGVRI 107
            ...|:: ....|.||.:|:..|.|:||..||   :..|.:|   ..|.|.:.|            
  Fly    65 WIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLNLLVVTGTVDWWDLYA------------ 117

  Fly   108 P---VAEVIMHPNYATG-GHNDLAVLRLQSPLTFDANIAAIQLATEDP-PNCVAVDISGWGNIAE 167
            |   |:::.:|.|:... .|||:|:|:|.|.:.|:.....|.||..|. .....:..:|||:...
  Fly   118 PYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELEEGDKLTFAGWGSSEA 182

  Fly   168 KGPLSDSLLFVQVTSISRGACRWMFYSRLPETM--ICLLHSKNSGACYGDSGGP-ATYGGKVVGL 229
            .|.....|.....|.:...|||....::....:  :|:......|||:||:||| .....::||:
  Fly   183 MGTYGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHGDTGGPLIDEQQRLVGI 247

  Fly   230 ASLLLGGGCGRAAPDGYLRISKVRAWI 256
            .:  .|..|||..||.|.|.:....||
  Fly   248 GN--WGVPCGRGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 66/234 (28%)
Tryp_SPc 37..219 CDD:238113 53/195 (27%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 66/234 (28%)
Tryp_SPc 52..275 CDD:238113 67/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.